Sequence details NCBI ID: XP_004865838.1 (Protein)

Details from NCBI annotation

Gene Symbol Gadd45b
Protein Name PREDICTED: growth arrest and DNA damage-inducible protein GADD45 beta [Heterocephalus glaber]

Database interlinks

Part of XM_004865781.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004865781.1 (Coding sequence)

Sequence Protein

Length: 160 aa     
View alignmentsRaw sequence   
>XP_004865838.1
MTLEELVTCDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAELLGEPAETQGATEARDLHCLLVTNPHTDAWKSHGLVEVASYCQESRGNNQWVPYISLQER