Sequence details NCBI ID: XP_004865664.1 (Protein)

Details from NCBI annotation

Gene Symbol Elof1
Protein Name PREDICTED: transcription elongation factor 1 homolog isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004865607.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004865607.1 (Coding sequence)

Sequence Protein

Length: 83 aa     
View alignmentsRaw sequence   
>XP_004865664.1
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ