Sequence details NCBI ID: XP_004864996.1 (Protein)

Details from NCBI annotation

Gene Symbol Sec61b
Protein Name PREDICTED: protein transport protein Sec61 subunit beta [Heterocephalus glaber]

Database interlinks

Part of XM_004864939.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004864939.1 (Coding sequence)

Sequence Protein

Length: 96 aa     
View alignmentsRaw sequence   
>XP_004864996.1
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS