Sequence details NCBI ID: XP_004864712.1 (Protein)

Details from NCBI annotation

Gene Symbol Atp6v0c
Protein Name PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Heterocephalus glaber]

Database interlinks

Part of XM_004864655.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004864655.1 (Coding sequence)

Sequence Protein

Length: 155 aa     
Raw sequence   
>XP_004864712.1
MSEAKSSPEYASFFAVIGASVAMIFSALGAAYGTAKSGTGIAAMSVMRPEQIMRSIIPVVMAGIIAIYGLVVAVLIANSLNEDITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK