Sequence details NCBI ID: XP_004864453.1 (Protein)

Details from NCBI annotation

Gene Symbol Tnnc1
Protein Name PREDICTED: troponin C, slow skeletal and cardiac muscles isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004864396.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004864396.1 (Coding sequence)

Sequence Protein

Length: 161 aa     
View alignmentsRaw sequence   
>XP_004864453.1
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE