Sequence details NCBI ID: XP_004863021.1 (Protein)

Details from NCBI annotation

Gene Symbol Letmd1
Protein Name PREDICTED: LETM1 domain-containing protein 1 isoform X8 [Heterocephalus glaber]

Database interlinks

Part of XM_004862964.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004862964.1 (Coding sequence)

Sequence Protein

Length: 320 aa     
View alignmentsRaw sequence   
>XP_004863021.1
MALSRVCWTRAALWGSAVAPGPVVTRRLQLGRSGLAWEAFRSSKLHLSPKSDMKSLISYVVTKTKVINGKYHRFLGRHFPRFYVLYTIFMKGLQMFWADAKKARRIKTNMWKQSIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQIDFLDIYHALRKQSHSEIISYLERVIPLVSDAGLQWHLTELCTKIQNGTHPAVQDILTLRECFSNHPLGINQLQAWQMKALSRAMLLTPYLPPPLLRHRLKTHTTVIHQLDRALAKLGIGQLSAQEVKLDHFSSECHRLAISVA