Sequence details NCBI ID: XP_004862864.1 (Protein)

Details from NCBI annotation

Gene Symbol Arpc5
Protein Name PREDICTED: actin-related protein 2/3 complex subunit 5 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004862807.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004862807.1 (Coding sequence)

Sequence Protein

Length: 154 aa     
Raw sequence   
>XP_004862864.1
MAKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKSGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV