Sequence details NCBI ID: XP_004862294.1 (Protein)

Details from NCBI annotation

Gene Symbol Phlda3
Protein Name PREDICTED: pleckstrin homology-like domain family A member 3 [Heterocephalus glaber]

Database interlinks

Part of XM_004862237.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004862237.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004862294.1
MTAAATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGAGTLVS