Sequence details NCBI ID: XP_004862144.1 (Protein)

Details from NCBI annotation

Gene Symbol Nucks1
Protein Name PREDICTED: nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004862087.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004862087.1 (Coding sequence)

Sequence Protein

Length: 242 aa     
View alignmentsRaw sequence   
>XP_004862144.1
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKKDDSHSAEDSEDEKDDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPPEEEEEGPESPAEKKAPASPPPEKSGDEGSEDEAPSGED