Sequence details NCBI ID: XP_004861884.1 (Protein)

Details from NCBI annotation

Gene Symbol Ucma
Protein Name PREDICTED: unique cartilage matrix-associated protein isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004861827.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861827.1 (Coding sequence)

Sequence Protein

Length: 138 aa     
View alignmentsRaw sequence   
>XP_004861884.1
MTRRQVLLLSCLSALVLLSMLREGSSASVGSRQTAGEAAQEGVRQKIFMQESDASNFLKGRGKRSPRSRYEANAENRQKLQADELRREYYEEQRNEFENFVEEQKDEQEERSREAVEQWRQWHYDGLFPSYLYNRYHV