Sequence details NCBI ID: XP_004861806.1 (Protein)

Details from NCBI annotation

Gene Symbol Acbd7
Protein Name PREDICTED: acyl-CoA-binding domain-containing protein 7 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004861749.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861749.1 (Coding sequence)

Sequence Protein

Length: 96 aa     
View alignmentsRaw sequence   
>XP_004861806.1
MGVAVWGPGPADFDKATADVRKLKARPEDEELKELYGLYKQAVAGDVSIGNSCPAVSGLKGKAKWEEWVLRKGLSEEDAMSAYISKAKELIEKYGI