Sequence details NCBI ID: XP_004861434.1 (Protein)

Details from NCBI annotation

Gene Symbol Bloc1s1
Protein Name PREDICTED: biogenesis of lysosome-related organelles complex 1 subunit 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004861377.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861377.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004861434.1
MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS