Sequence details NCBI ID: XP_004861301.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufa4l2
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004861244.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861244.1 (Coding sequence)

Sequence Protein

Length: 86 aa     
View alignmentsRaw sequence   
>XP_004861301.1
MAGTSLGARFYRQIKRHPGLIPMISFIGLGMGSAALYLLRLALRSPDVCWDRKNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF