Sequence details NCBI ID: XP_004861286.1 (Protein)

Details from NCBI annotation

Gene Symbol Ddit3
Protein Name PREDICTED: DNA damage-inducible transcript 3 protein isoform X5 [Heterocephalus glaber]

Database interlinks

Part of XM_004861229.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861229.1 (Coding sequence)

Sequence Protein

Length: 167 aa     
View alignmentsRaw sequence   
>XP_004861286.1
MAAESLPFSFGAVSNWELEAWYEDLQEVLSSDENGGNYISPPGNEEEESKTFTTLDPASLAWLTEEPGPPEITSTSQSPRSPDSSQSSLAQEEEEDQGRTRKRKQSGQWPVRAGKQRVKEKEQENERKVAQLTEENERLKQEIECLTREVEATRRALIDRMVNLHQA