Sequence details NCBI ID: XP_004861161.1 (Protein)

Details from NCBI annotation

Gene Symbol Hmga2
Protein Name PREDICTED: high mobility group protein HMGI-C isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004861104.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004861104.1 (Coding sequence)

Sequence Protein

Length: 80 aa     
View alignmentsRaw sequence   
>XP_004861161.1
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED