Sequence details NCBI ID: XP_004861016.1 (Protein)

Details from NCBI annotation

Gene Symbol Ppp1r27
Protein Name PREDICTED: protein phosphatase 1 regulatory subunit 27 [Heterocephalus glaber]

Database interlinks

Part of XM_004860959.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004860959.1 (Coding sequence)

Sequence Protein

Length: 154 aa     
View alignmentsRaw sequence   
>XP_004861016.1
MPSRTVRYSRYSPRQRRQRLMAYRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLDTIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDETGWTPLHIACSDGYPDIARYLISLGADREAANDDGDLPSDLIDPDFKDLVELFKGASVD