Sequence details NCBI ID: XP_004860722.1 (Protein)

Details from NCBI annotation

Gene Symbol Grb2
Protein Name PREDICTED: growth factor receptor-bound protein 2 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004860665.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004860665.1 (Coding sequence)

Sequence Protein

Length: 216 aa     
View alignmentsRaw sequence   
>XP_004860722.1
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV