Sequence details NCBI ID: XP_004860495.1 (Protein)

Details from NCBI annotation

Gene Symbol Atp6v0e2
Protein Name PREDICTED: V-type proton ATPase subunit e 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004860438.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004860438.1 (Coding sequence)

Sequence Protein

Length: 81 aa     
View alignmentsRaw sequence   
>XP_004860495.1
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATSVCCYLFWLLAILSQLNPLFGPQLKNETIWYVRFLWE