Sequence details NCBI ID: XP_004860298.1 (Protein)

Details from NCBI annotation

Gene Symbol Smim8
Protein Name PREDICTED: small integral membrane protein 8 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004860241.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004860241.1 (Coding sequence)

Sequence Protein

Length: 97 aa     
Raw sequence   
>XP_004860298.1
MSSAPEPPTFKKELPKEKDFQNPGLRGVRTTTLFRAINPELFIKPNKPVMAFGLVSLSLCVAYIGYLHATQENKKDLYEAVDSEGHSYMRRKTSKWD