Sequence details NCBI ID: XP_004860197.1 (Protein)

Details from NCBI annotation

Gene Symbol Nkain2
Protein Name PREDICTED: sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004860140.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004860140.1 (Coding sequence)

Sequence Protein

Length: 208 aa     
Raw sequence   
>XP_004860197.1
MGYCSGRCTLISVCGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLLLTFNISMHRSWWMENGPGCMVTSVTPAPDWAPEDHRYITVSGCLLEYQYVEVAHSALQIALALAGFVYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK