Sequence details NCBI ID: XP_004859699.1 (Protein)

Details from NCBI annotation

Gene Symbol Gngt2
Protein Name PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 [Heterocephalus glaber]

Database interlinks

Part of XM_004859642.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004859642.1 (Coding sequence)

Sequence Protein

Length: 69 aa     
View alignmentsRaw sequence   
>XP_004859699.1
MAQDLSKKELLRLEVEQLRKEVKNPRAPVSRTGKEIKDYVEAQAGRDPLLRGVPEDRNPFKEKGGCLRS