Sequence details NCBI ID: XP_004859537.1 (Protein)

Details from NCBI annotation

Gene Symbol Zpbp2
Protein Name PREDICTED: zona pellucida-binding protein 2 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004859480.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004859480.1 (Coding sequence)

Sequence Protein

Length: 253 aa     
View alignmentsRaw sequence   
>XP_004859537.1
MRAWLLLSAVLCYLARIAWSRSSLLSEKGLVFGKIGHPVKIYVKLHQNSPVLVCMDSQRASKETVDPTYLWIGPNEKIVTGNNRINITKTGRLILKDFLEHLSGLYKCAFSYKTIKAETQQETVVKKRYDFMVFVNPFAPGWRGACNESGDCEDVTNHNILKARDQIKEFFRSQADIFYHHFNKTRHAMHFVDHSFHVVRVDSCRPGFGKNEGLHSNCASCCVVCSPGTFSPDVDVTCQICISVHVCGAKSCP