Sequence details NCBI ID: XP_004859448.1 (Protein)

Details from NCBI annotation

Gene Symbol Eif1
Protein Name PREDICTED: eukaryotic translation initiation factor 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004859391.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004859391.1 (Coding sequence)

Sequence Protein

Length: 113 aa     
Raw sequence   
>XP_004859448.1
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF