Sequence details NCBI ID: XP_004859009.1 (Protein)

Details from NCBI annotation

Gene Symbol Tyrobp
Protein Name PREDICTED: TYRO protein tyrosine kinase-binding protein isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004858952.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858952.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004859009.1
MGGPEPSWRLLLLPLLLTVAGVSPVQAQSGCNCAPVSAGVLAGIVLGDLVLTLLIALAVYSLGRLVPRGRKTAQMTRKQPITETESPYQVRKPDSSPLLPILTSRSCLLSSTNTLIPLSQQFPQS