Sequence details NCBI ID: XP_004858806.1 (Protein)

Details from NCBI annotation

Gene Symbol Dusp23
Protein Name PREDICTED: dual specificity protein phosphatase 23 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004858749.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858749.1 (Coding sequence)

Sequence Protein

Length: 150 aa     
View alignmentsRaw sequence   
>XP_004858806.1
MGVQPSNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTEHGPPHGTSSPGLTLHRLRIPDFCPPAPDQIDHFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKEQGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK