Sequence details NCBI ID: XP_004858757.1 (Protein)

Details from NCBI annotation

Gene Symbol Tstd1
Protein Name PREDICTED: thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004858700.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858700.1 (Coding sequence)

Sequence Protein

Length: 135 aa     
View alignmentsRaw sequence   
>XP_004858757.1
MLQAPGRRTGFLRLATAVRAMAAGPTVLLPELRALLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAKKPKLEDENLVFFCQMGKRGLQATQLAQSLGYTGAQNYAGAYQEWSEKVG