Sequence details NCBI ID: XP_004858720.1 (Protein)

Details from NCBI annotation

Gene Symbol Fcer1g
Protein Name PREDICTED: high affinity immunoglobulin epsilon receptor subunit gamma [Heterocephalus glaber]

Database interlinks

Part of XM_004858663.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858663.1 (Coding sequence)

Sequence Protein

Length: 87 aa     
View alignmentsRaw sequence   
>XP_004858720.1
MMFPAVLLLLLLLVEQAAALGEPQLCYILDAILFLYGIILTLLYCRLKIQVRKAAIASFEKSDGIYTGLSTRNQETYETLKHEKPPQ