Sequence details NCBI ID: XP_004858711.1 (Protein)

Details from NCBI annotation

Gene Symbol Pcp4l1
Protein Name PREDICTED: Purkinje cell protein 4-like protein 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004858654.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004858654.1 (Coding sequence)

Sequence Protein

Length: 68 aa     
View alignmentsRaw sequence   
>XP_004858711.1
MSELNTKTSPATNQTSSPEEKGKAGNAKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS