Sequence details NCBI ID: XP_004857641.1 (Protein)

Details from NCBI annotation

Gene Symbol Scimp
Protein Name PREDICTED: SLP adapter and CSK-interacting membrane protein [Heterocephalus glaber]

Database interlinks

Part of XM_004857584.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004857584.1 (Coding sequence)

Sequence Protein

Length: 146 aa     
View alignmentsRaw sequence   
>XP_004857641.1
MSWWRNYFWIILAVAIVVVSLVLGFLLYCVYRWQFKQGKKWEIAKPLKQNQREEEKMYENVQSPDPLPPLPPRGSFSQGNFAPQEIPATYSLVNKATNKKTVPTLSYIDPENDYDDVEIPGNTQNHNSKTSISSFWHAEESSHNLY