Sequence details NCBI ID: XP_004857336.1 (Protein)

Details from NCBI annotation

Gene Symbol Vmo1
Protein Name PREDICTED: vitelline membrane outer layer protein 1 homolog [Heterocephalus glaber]

Database interlinks

Part of XM_004857279.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004857279.1 (Coding sequence)

Sequence Protein

Length: 196 aa     
View alignmentsRaw sequence   
>XP_004857336.1
MGQDTGAGLLVLLCATSFRHSVADGLRGQTSVIEVTNGGPWGDWAWPEMCPNGYFASGFSLKVEPVQGIPGDDTALNGIRLHCTRGDTEHVIESKSGRWGVWSEPMWCPDRGFLVAFALRVEPALTPGDNTAANNLRFRCSDGTELEGPGLSWGEFGNWSDSCSKGVCGLQTKIEEPRGFHDDTALNDLQLFCCRS