Sequence details NCBI ID: XP_004857316.1 (Protein)

Details from NCBI annotation

Gene Symbol Med31
Protein Name PREDICTED: mediator of RNA polymerase II transcription subunit 31 [Heterocephalus glaber]

Database interlinks

Part of XM_004857259.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004857259.1 (Coding sequence)

Sequence Protein

Length: 131 aa     
View alignmentsRaw sequence   
>XP_004857316.1
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK