Sequence details NCBI ID: XP_004857277.1 (Protein)

Details from NCBI annotation

Gene Symbol Emc6
Protein Name PREDICTED: ER membrane protein complex subunit 6 [Heterocephalus glaber]

Database interlinks

Part of XM_004857220.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004857220.1 (Coding sequence)

Sequence Protein

Length: 110 aa     
View alignmentsRaw sequence   
>XP_004857277.1
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASILLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY