Sequence details NCBI ID: XP_004857031.1 (Protein)

Details from NCBI annotation

Gene Symbol Ift20
Protein Name PREDICTED: intraflagellar transport protein 20 homolog isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004856974.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004856974.1 (Coding sequence)

Sequence Protein

Length: 132 aa     
View alignmentsRaw sequence   
>XP_004857031.1
MAKDILGEAGLHFDELNKLRVLDPEVTQQTTELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK