Sequence details NCBI ID: XP_004856848.1 (Protein)

Details from NCBI annotation

Gene Symbol Ccdc153
Protein Name PREDICTED: actin cytoskeleton-regulatory complex protein pan1 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004856791.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004856791.1 (Coding sequence)

Sequence Protein

Length: 198 aa     
View alignmentsRaw sequence   
>XP_004856848.1
MPPKTKGKRRKTGEQKKKNSGAGATPAGSADRDPSKLKLNQFARADVESEAKHSLVLLEKELLQDHLAIWRAEARRAKASEDQLKQRLQELAAELERARSEGKAIFAEMSRQHRALQNEMDAHRKQLEEEVKCLREQLETCQRETEASRKEAERVLGERDRTLAQLRAHVTDMEAKFEEILDPGPSLGQAASHQASVG