Sequence details NCBI ID: XP_004856736.1 (Protein)

Details from NCBI annotation

Gene Symbol Fxyd2
Protein Name PREDICTED: sodium/potassium-transporting ATPase subunit gamma isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004856679.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004856679.1 (Coding sequence)

Sequence Protein

Length: 64 aa     
View alignmentsRaw sequence   
>XP_004856736.1
MDRWHLGGSSKGDVDPFHYDYETVRNGGLIFAGLAFVVGLIILLSKRFRCGGSRKPRQVGEDEL