Sequence details NCBI ID: XP_004856615.1 (Protein)

Details from NCBI annotation

Gene Symbol Hspb2
Protein Name PREDICTED: heat shock protein beta-2 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004856558.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004856558.1 (Coding sequence)

Sequence Protein

Length: 184 aa     
View alignmentsRaw sequence   
>XP_004856615.1
MSGRSVPHAHPATAEYEFANPSHLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAQSGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPGDVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPEPEEEEEEEAARVEP