Sequence details NCBI ID: XP_004856358.1 (Protein)

Details from NCBI annotation

Gene Symbol Ppp1r17
Protein Name PREDICTED: protein phosphatase 1 regulatory subunit 17 [Heterocephalus glaber]

Database interlinks

Part of XM_004856301.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004856301.1 (Coding sequence)

Sequence Protein

Length: 155 aa     
View alignmentsRaw sequence   
>XP_004856358.1
MMSTEQMQSPELSEDRLDKLDPRCSHLDDLPDQFIKGCDLKKKPRKGKNMQATLTVESDQKKPRRKDTPALHIPPFIPGVISEHLIKRYDIQERHPKSKMSPALHNTDLEQKRPRRKDTPALHVPPFTADVTLLRDERPKVIMEDDEKDGDKIAV