Sequence details NCBI ID: XP_004856280.1 (Protein)

Details from NCBI annotation

Gene Symbol Vkorc1
Protein Name PREDICTED: vitamin K epoxide reductase complex subunit 1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004856223.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004856223.1 (Coding sequence)

Sequence Protein

Length: 163 aa     
Raw sequence   
>XP_004856280.1
MGSTWRNPGWVRLGLCVAGLVLSFYALHVKVARARDPDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGADSILNQSNSVFGCIFYSLQLLLGSLRGRWASVLLVLSSLVSLAGSIYLAWILFFVLYDFCVVCITTYAVNVGLMWLSFREFREPQAKAKQH