Sequence details NCBI ID: XP_004855945.1 (Protein)

Details from NCBI annotation

Gene Symbol Lyrm1
Protein Name PREDICTED: LYR motif-containing protein 1 isoform X9 [Heterocephalus glaber]

Database interlinks

Part of XM_004855888.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855888.1 (Coding sequence)

Sequence Protein

Length: 122 aa     
View alignmentsRaw sequence   
>XP_004855945.1
MTTATRQEVLSLYRSIFRLARKWQAASGQMEDTMEEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYQIPYPRPIHLPPMGLTPLRGRGLRTQEKLRKLSKPVYLMSHDEVS