Sequence details NCBI ID: XP_004855931.1 (Protein)

Details from NCBI annotation

Gene Symbol Litaf
Protein Name PREDICTED: lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog isoform X6 [Heterocephalus glaber]

Database interlinks

Part of XM_004855874.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855874.1 (Coding sequence)

Sequence Protein

Length: 162 aa     
View alignmentsRaw sequence   
>XP_004855931.1
MSVPGPYQAAPGPSSVPTAPPSYEETVRVTNYMPTPPAPGPGPTTGLMTGPDGKGVNPPLYYTQPMPVLNPSANTTVQTVFVQQPVSFFDRPIQMCCPSCNKMIVTRLSYSAGALTWLSCGSLCLLGCILGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL