Sequence details NCBI ID: XP_004855780.1 (Protein)

Details from NCBI annotation

Gene Symbol Gtf2a2
Protein Name PREDICTED: transcription initiation factor IIA subunit 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004855723.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855723.1 (Coding sequence)

Sequence Protein

Length: 109 aa     
View alignmentsRaw sequence   
>XP_004855780.1
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE