Sequence details NCBI ID: XP_004855432.1 (Protein)

Details from NCBI annotation

Gene Symbol Eif4ebp1
Protein Name PREDICTED: eukaryotic translation initiation factor 4E-binding protein 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004855375.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004855375.1 (Coding sequence)

Sequence Protein

Length: 118 aa     
View alignmentsRaw sequence   
>XP_004855432.1
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPRDLPTIPGVTSPSSDEPSMEASQSHLRSSLEDKPAGSEESQFEMDI