Sequence details NCBI ID: XP_004855046.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufc1
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004854989.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004854989.1 (Coding sequence)

Sequence Protein

Length: 76 aa     
View alignmentsRaw sequence   
>XP_004855046.1
MAPSMLLRPLSRLLAPARLSSGSSARSKFYVRDPPVDKPNWLKVGLTVGTTAFLWCYLIKQHHEDVLEYKRRNGLE