Sequence details NCBI ID: XP_004854942.1 (Protein)

Details from NCBI annotation

Gene Symbol Gjb2
Protein Name PREDICTED: gap junction beta-2 protein isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004854885.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004854885.1 (Coding sequence)

Sequence Protein

Length: 226 aa     
View alignmentsRaw sequence   
>XP_004854942.1
MDWGALHTILGGVNKYSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFICNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEMKSEFKDIEEIKSEKVRIEGSLWWTYTSSVFFRVIFEGAFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMITVSGICILLNVTELCYLFIRYCSRKSKKPV