Sequence details NCBI ID: XP_004854920.1 (Protein)

Details from NCBI annotation

Gene Symbol Sap18
Protein Name PREDICTED: histone deacetylase complex subunit SAP18 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004854863.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004854863.1 (Coding sequence)

Sequence Protein

Length: 172 aa     
Raw sequence   
>XP_004854920.1
MLAAGVGGQGERLAAKRKKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRIRPY