Sequence details NCBI ID: XP_004853808.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: protein FAM19A3 [Heterocephalus glaber]

Database interlinks

Part of XM_004853751.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004853751.1 (Coding sequence)

Sequence Protein

Length: 133 aa     
Raw sequence   
>XP_004853808.1
MSGRAMWNWSPGGWLLASCLAWLWTCLALASLQPPTATVLVKQGTCEVIDAHRCCTRNRIEERSQTVKCPCFSGQVAGTTRAKPSCVDASIVLQRWWCHMEPCLPGEECKVFPDLSGWSCSSGHKVKTTKVTR