Sequence details NCBI ID: XP_004853806.1 (Protein)

Details from NCBI annotation

Gene Symbol Rhoc
Protein Name PREDICTED: rho-related GTP-binding protein RhoC isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004853749.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004853749.1 (Coding sequence)

Sequence Protein

Length: 193 aa     
View alignmentsRaw sequence   
>XP_004853806.1
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL