Sequence details NCBI ID: XP_004853479.1 (Protein)

Details from NCBI annotation

Gene Symbol Tnfsf4
Protein Name PREDICTED: tumor necrosis factor ligand superfamily member 4 [Heterocephalus glaber]

Database interlinks

Part of XM_004853422.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004853422.1 (Coding sequence)

Sequence Protein

Length: 181 aa     
View alignmentsRaw sequence   
>XP_004853479.1
MKMEGVQPLEENVGSVPRPRPQWNKLLLVVSVIQGLGLLLCLIYICLRVSAPQVQHPPIQSISILLTGCEEEKLILIPNDAHIMKVENNSVIINCDGFYLISVKGYFQEEVSISLHYRMHRNPISVPLRKDLQVDFTTVVSLAYKDKVYLSMNSPNTSCKDFRMNGGELYLIQQNPGGFCI