Sequence details NCBI ID: XP_004853292.1 (Protein)

Details from NCBI annotation

Gene Symbol Twsg1
Protein Name PREDICTED: twisted gastrulation protein homolog 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004853235.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004853235.1 (Coding sequence)

Sequence Protein

Length: 223 aa     
View alignmentsRaw sequence   
>XP_004853292.1
MKSHCVAALTLAGLMFLMWLPGSLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF