Sequence details NCBI ID: XP_004853170.1 (Protein)

Details from NCBI annotation

Gene Symbol Rnf125
Protein Name PREDICTED: E3 ubiquitin-protein ligase RNF125 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004853113.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004853113.1 (Coding sequence)

Sequence Protein

Length: 231 aa     
View alignmentsRaw sequence   
>XP_004853170.1
MGSLLSSDAAKAAPAPPAPRARERRADPPLPLASFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVARRMKSEFQNCAECDALVCLSEMRAHIRTCEKYIDTYGPLQELEETTRCVCPFCQRELDEDSLLDHCITHHRSERRPVFCPLCHFIPNENPGSFNGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRALDQSLLEYVNHSNTT